The domain within your query sequence starts at position 668 and ends at position 764; the E-value for the HHH_7 domain shown below is 1.6e-6.

DPKHIGVGMYQHDVSQTLLKATLDSVVEECVSFVGVDINICSEVLLRHIAGLNANRAKNI
IEWREKNGPFINREQLKKVKGLGPKSFQQCAGFVRIN

HHH_7

HHH_7
PFAM accession number:PF14635
Interpro abstract (IPR032706): This entry represents a helix-hairpin-helix motif found in the transcription elongation factor Spt6 [(PUBMED:21094070)]. Spt6 is involved in the regulation of histone modification [(PUBMED:24107707)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HHH_7