The domain within your query sequence starts at position 472 and ends at position 505; the E-value for the HIF-1 domain shown below is 1.8e-18.
DIAQDPDTLDLEMLAPYISMDDDFQLNSSEQLPK
HIF-1 |
---|
PFAM accession number: | PF11413 |
---|---|
Interpro abstract (IPR021537): | Hypoxia-inducible factors (HIFs) are transcription factors that respond to changes in available oxygen in the cellular environment. Specifically, they respond to decreases in oxygen, mediating the effects of hypoxia [ (PUBMED:18410568) ]. HIFs are heterodimers, composed of an alpha and a beta subunit. At least 3 different alpha subunits are known to exist, termed HIF-1, -2 and -3 alpha. Beta subunits, meanwhile, are constitutively-expressed aryl hydrocarbon receptor nuclear translocators (ARNTs). In addition to their role in hypoxia, HIFs have been shown to be involved in a range of processes, including angiogenesis, metal transport, mitochondrial function and cell growth [ (PUBMED:19756382) ]. This entry represents HIF alpha subunits. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HIF-1