The domain within your query sequence starts at position 771 and ends at position 810; the E-value for the HIF-1a_CTAD domain shown below is 1.2e-25.
MDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
HIF-1a_CTAD |
---|
PFAM accession number: | PF08778 |
---|---|
Interpro abstract (IPR014887): | Hypoxia inducible factor-1 alpha (HIF-1 alpha) is the regulatory subunit of the heterodimeric transcription factor HIF-1. It plays a key role in cellular response to low oxygen tension. This region corresponds to the C-terminal transactivation domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HIF-1a_CTAD