The domain within your query sequence starts at position 781 and ends at position 948; the E-value for the HIN domain shown below is 1.8e-78.

HQGPKQVMVLKVTEPFTYDLEEDKRMFHATVATETEFFRVKVFDTALISKFIPRNIIAIS
DYFGCNGFLEIYRASCVSDVNVNPTMVISNTLRQRANATPKISYLFSQAKGTFVSGEYLV
IKKTERNKAIYYGVKDNTGKMEVMVYGRLTNITCEPGNKLRLVCFELN

HIN

HIN
PFAM accession number:PF02760
Interpro abstract (IPR004021): This domain has no known function. It is found in one or two copies per protein, and is found associated with the PAAD/DAPIN domain IPR004020.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HIN