The domain within your query sequence starts at position 1265 and ends at position 1387; the E-value for the HMMR_C domain shown below is 3.5e-12.

KMKTNLEEVQSALHSKEKACHRMSEEIERTRTLESRAFQEKEQLRSKLEEMYEERERTFL
EMEMLKKQLEFLAEENGKLVGHQNLHQKIQYVVRLKKENIRLTEETEKLRAENLFLKEKK
KEF

HMMR_C

HMMR_C
PFAM accession number:PF15908
Interpro abstract (IPR031794):

This domain corresponds to the C-terminal region of eukaryotic hyaluronan-mediated motility receptor protein (RHAMM), and may be involved in centrosome targeting [(PUBMED:12808028)]. This domain is also found C-terminal in kinesin-like protein KIF15 [(PUBMED:24419385)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HMMR_C