The domain within your query sequence starts at position 15 and ends at position 339; the E-value for the HMMR_N domain shown below is 1.2e-136.

SGCAPSPGAYDVKTSEATKGPVSFQKSQRFKNQRESQQNLNIDKDTTLLASAKKAKKSVS
KKDSQKNDKDVKRLEKEIRALLQERGTQDKRIQDMESELEKTEAKLNAAVREKTSLSASN
ASLEKRLTELTRANELLKAKFSEDGHQKNMRALSLELMKLRNKRETKMRSMMVKQEGMEL
KLQATQKDLTESKGKIVQLEGKLVSIEKEKIDEKCETEKLLEYIQEISCASDQVEKCKVD
IAQLEEDLKEKDREILSLKQSLEENITFSKQIEDLTVKCQLLETERDNLVSKDRERAETL
SAEMQILTERLALERQEYEKLQQKE

HMMR_N

HMMR_N
PFAM accession number:PF15905
Interpro abstract (IPR031787):

This entry represents the N-terminal region of eukaryotic hyaluronan-mediated motility receptor proteins. The protein is functionally associated with BRCA1 and thus predicted to be a common, low-penetrance breast cancer candidate [(PUBMED:9601098), (PUBMED:19064580)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HMMR_N