The domain within your query sequence starts at position 540 and ends at position 627; the E-value for the HNF-1A_C domain shown below is 3.4e-38.

VFTSDTEASSEPGLHEPPSPATTIHIPSQDPSNIQHLQPAHRLSTSPTVSSSSLVLYQSS
DSNGHSHLLPSNHSVIETFISTQMASSS

HNF-1A_C

HNF-1A_C
PFAM accession number:PF04813
Interpro abstract (IPR006898): This domain consists of an alternative C terminus of homeobox-containing transcription factor HNF-1, found in the HNF-1A isoform. Different isoforms of HNF-1 are generated by the differential use of polyadenylation sites and by alternative splicing. The C-terminal region of HNF-1 is responsible for the activation of transcription, and HNF-1A, which has this C-terminal extension, transactivates less well than the B and C isoforms [(PUBMED:7900999)]. Mutations and polymorphisms in HNF-1 cause the type 3 form of maturity-onset diabetes of the young (MODY3) [(PUBMED:9133564)].
GO process:positive regulation of transcription, DNA-templated (GO:0045893)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HNF-1A_C