The domain within your query sequence starts at position 380 and ends at position 454; the E-value for the HNF_C domain shown below is 5.5e-28.

NHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGGYGSPMPGSLAMGPVTNKA
GLDASPLAADTSYYQ

HNF_C

HNF_C
PFAM accession number:PF09354
Interpro abstract (IPR018533):

This presumed domain is found in the C-terminal region of Hepatocyte Nuclear Factor 3 alpha and beta chains. Its specific function is uncertain. The N-terminal region of this presumed domain contains an EH1 (engrailed homology 1) motif, that is characterised by the FxIxxIL sequence [ (PUBMED:16309560) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HNF_C