The domain within your query sequence starts at position 393 and ends at position 457; the E-value for the HNF_C domain shown below is 1.3e-30.
NHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGATLPASLPLGSASVATRSPIEPSALE PAYYQ
HNF_C |
---|
PFAM accession number: | PF09354 |
---|---|
Interpro abstract (IPR018533): | This presumed domain is found in the C-terminal region of Hepatocyte Nuclear Factor 3 alpha and beta chains. Its specific function is uncertain. The N-terminal region of this presumed domain contains an EH1 (engrailed homology 1) motif, that is characterised by the FxIxxIL sequence [ (PUBMED:16309560) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HNF_C