The domain within your query sequence starts at position 2 and ends at position 166; the E-value for the HNOB domain shown below is 3.4e-58.

YGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNL
NAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFR
CTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKV

HNOB

HNOB
PFAM accession number:PF07700
Interpro abstract (IPR011644):

The HNOB (Haem NO Binding) domain is a predominantly alpha-helical domain and binds heme via a covalent linkage to histidine [(PUBMED:12590654)]. This domain is found in soluble guanylate cyclases, which are nitric oxide-responsive signaling proteins. It is predicted to function as a haem-dependent sensor for gaseous ligands and to transduce diverse downstream signals in both bacteria and animals. In Clostridium botulinum displays femtomolar affinity for nitrous oxide (NO) [(PUBMED:15472039)].

GO function:heme binding (GO:0020037)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HNOB