The domain within your query sequence starts at position 477 and ends at position 622; the E-value for the HOIP-UBA domain shown below is 2.4e-54.
KMRKEGLQLVSMIQEGETAGASPEEVFSALQYSGTEVPLQWLRSELSYVLEMVAELAGQQ DPELGAFSCQEARKAWLDRHGNLDEAVEECVRARRRKVHELQSLGFGPKEGSLQALFQHG GDVARALTELQRQRLEPFHQRLWDRD
HOIP-UBA |
---|
PFAM accession number: | PF16678 |
---|---|
Interpro abstract (IPR032065): | This entry represents a binding domain found in E3 ubiquitin-protein ligase RNF31 like proteins. RNF31 is also known as HOIL-1L binding partner (HOIP). The interaction of HOIL-1L and HOIP is via the UBL-UBA interaction. This interaction is important in E3 complex formation and the subsequent activation of NF-kappaB [ (PUBMED:22430200) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HOIP-UBA