The domain within your query sequence starts at position 24 and ends at position 221; the E-value for the HORMA domain shown below is 4.7e-63.
EHQSLMFVKRLLAVSVSCITYLRGIFPERAYGTRYLDDLCVKILKEDKNCPGSSQLVKWM LGCYDALQKKYLRMIILAVYTNPGDPQTISECYQFKFKYTKNGPIMDFISKNQNNKSSTT SADTKKASILLIRKIYVLMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVI FDGDPTYLNVGEVPTPFH
HORMA |
---|
PFAM accession number: | PF02301 |
---|---|
Interpro abstract (IPR003511): | The HORMA domain (for HOP1, REV7 and MAD2) is an about 180-240 amino acids region containing several conserved motifs. Whereas the MAD2 and the REV7 proteins are almost entirely made up of HORMA domains, HOP1 contains a HORMA domain in its N-terminal region and a Zn-finger domain, whose general arrangement of metal-chelating residues is similar to that of the PHD finger, in the C-terminal region. The HORMA domain is found in proteins showing a direct association with chromatin of all crown group eukaryotes. It has been suggested that the HORMA domain recognises chromatin states that result from DNA adducts, double-stranded breaks or non-attachment to the spindle and acts as an adaptor that recruits other proteins involved in repair [ (PUBMED:9757827) ]. Secondary structure prediction suggests that the HORMA domain is globular and could potentially form a complex beta-sheet(s) with associated alpha-helices [ (PUBMED:9757827) ]. Some proteins known to contain a HORMA domain are listed below:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HORMA