SMART: Pfam domain HPD

The domain within your query sequence starts at position 579 and ends at position 732; the E-value for the HPD domain shown below is 2.2e-86.

GLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKY
ARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIA
GKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQ

HPD

PFAM accession number:	PF05044
Interpro abstract (IPR023082):	This entry represents the homeo-prospero domain. This domain consists of a homeodomain-homology N-terminal region and the prospero-specific C-terminal region. The structure of these two regions consists of a single structural unit (a homeo-prospero domain), in which the prospero domain region is in position to contribute to DNA binding and also to mask a defined nuclear export signal that is within the putative homeodomain region. It is proposed that the homeo-prospero domain coordinately regulates prospero nuclear localisation and DNA binding specificity [ (PUBMED:12429095) ]. Prospero is a large Drosophila transcription factor protein that is expressed in all neural lineages of Drosophila embryos. It is needed for correct expression of several neural proteins and in determining the cell fates of neural stem cells. Homologues of prospero are found in a wide range of animals including humans with the highest level of similarity being found in the C-terminal 160 amino acids. This region was identified as containing an atypical homeobox domain followed by a prospero domain. However, the structure shows that these two regions form a single stable structural domain as defined here [ (PUBMED:15837198) ]. This homeo-prospero domain binds to DNA.
GO function:	DNA binding (GO:0003677)

PFAM accession number:

PF05044

Interpro abstract (IPR023082):

This entry represents the homeo-prospero domain. This domain consists of a homeodomain-homology N-terminal region and the prospero-specific C-terminal region. The structure of these two regions consists of a single structural unit (a homeo-prospero domain), in which the prospero domain region is in position to contribute to DNA binding and also to mask a defined nuclear export signal that is within the putative homeodomain region. It is proposed that the homeo-prospero domain coordinately regulates prospero nuclear localisation and DNA binding specificity [ (PUBMED:12429095) ].

Prospero is a large Drosophila transcription factor protein that is expressed in all neural lineages of Drosophila embryos. It is needed for correct expression of several neural proteins and in determining the cell fates of neural stem cells. Homologues of prospero are found in a wide range of animals including humans with the highest level of similarity being found in the C-terminal 160 amino acids. This region was identified as containing an atypical homeobox domain followed by a prospero domain. However, the structure shows that these two regions form a single stable structural domain as defined here [ (PUBMED:15837198) ]. This homeo-prospero domain binds to DNA.

GO function:

DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HPD