The domain within your query sequence starts at position 527 and ends at position 890; the E-value for the HPHLAWLY domain shown below is 9.1e-133.

PTDSNGKLPSLAVQSQLPPQLPGDESLDSIGSFEEGSDTSMQIRAGFDESSTTKEVKQSH
AMKQEMVDQSENRTIVTALRAPVSPAGSVTPERSLRSNSFGGNWKNKVPSPGLSLQEPTV
DKTVDEGKDGRQVKAISAADTSENRPTSRKSSCESISELLYRDGFTSPCYSEDFCTTENN
SRSLPAPDSSTGVEHVQKGSRASKSSEARLSTRKNSSDSSSVLTPPFSAGSPVCSHKRSR
ALKIHDSLEEASSLSTSDFSSQWTNEKENQADPGSSKVMRKGRDSSTKLKVRAGHKSSEK
SQSPRTSQVSSYEPSNLSELELKAIDDSDLADFQEEEDGLGSLRISRQCKDICELVINKL
PGYT

HPHLAWLY

HPHLAWLY
PFAM accession number:PF14925
Interpro abstract (IPR026679): Microtubule-associated protein 10 (MAP10, also known as MTR120/KIAA1383) localises to stabilised MTs during interphase and to the mitotic apparatus during mitosis. It may promote microtubule stability and ensures normal progress of cytokinesis [(PUBMED:23264731)].
GO process:microtubule cytoskeleton organization (GO:0000226)
GO function:microtubule binding (GO:0008017)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HPHLAWLY