The domain within your query sequence starts at position 71 and ends at position 122; the E-value for the HRG domain shown below is 3.8e-21.
LRGFFFVGALFSAVSVSAFCTFLALAITQHQSLKDPNSYYLSCVWSFISFKW
HRG |
---|
PFAM accession number: | PF16954 |
---|---|
Interpro abstract (IPR026218): | Haems are metalloporphyrins that serve as prosthetic groups for a variety of biological processes, including respiration, gas sensing, xenobiotic detoxification, cell differentiation, circadian clock control, metabolic reprogramming and microRNA processing. Haem is usually synthesised by a multistep biosynthetic pathway. The cellular pathways and molecules that mediate intracellular haem trafficking are still largely unknown [ (PUBMED:18418376) ]. Caenorhabditis elegans and related helminths are natural haem auxotrophs that acquire environmental haem for incorporation into haemoproteins. In C.elegans, it has been shown that HRG-1 proteins are essential for haem homeostasis. In worms, depletion of hrg-1, or its paralogue hrg-4, results in the disruption of organismal haem sensing, and an abnormal response to haem analogues [ (PUBMED:18418376) ]. HRG-1 and HRG-4 are transmembrane (TM) proteins that reside in distinct intracellular compartments. Transient knockdown of hrg-1 in zebrafish leads to hydrocephalus, yolk tube malformations and profound defects in erythropoiesis-phenotypes that are fully rescued by worm HRG-1. Human and worm proteins have been shown to co-localise, and bind and transport haem, thus establishing an evolutionarily conserved function for HRG-1 [ (PUBMED:18418376) ]. Sequence analysis of HRG-1 has identified 4 predicted TM domains, and a conserved tyrosine and acidic-di-leucine-based sorting signal in the cytoplasmic C terminus. In addition, residues that could potentially either directly bind haem (H90 in TM2) or interact with the haem side chains (FARKY) are situated in the C-terminal tail [ (PUBMED:18418376) ]. |
GO process: | heme transport (GO:0015886) |
GO function: | heme transmembrane transporter activity (GO:0015232) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HRG