The domain within your query sequence starts at position 44 and ends at position 358; the E-value for the HSL_N domain shown below is 4.6e-148.

MDLRTMTQSLVTLAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPTLGQLLGVAHH
FDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRKSIFFRASHNLAELEAYLAALTQ
LRAMAYYAQRLLTINRPGVLFFEGDEGLTADFLQEYVTLHKGCFYGRCLGFQFTPAIRPF
LQTLSIGLVSFGEHYKRNETGLSVTASSLFTGGRFAIDPELRGAEFERIIQNLDVHFWKA
FWNITEIEVLSSLANMASTTVRVSRLLSLPPEAFEMPLTSDPRLTVTISPPLAHTGPAPV
LARLISYDLREGQDS

HSL_N

HSL_N
PFAM accession number:PF06350
Interpro abstract (IPR010468):

This domain is found in several mammalian hormone-sensitive lipase (HSL) proteins. Hormone-sensitive lipase, a key enzyme in fatty acid mobilisation, overall energy homeostasis, and possibly steroidogenesis, is acutely controlled via reversible phosphorylation by catecholamines and insulin [(PUBMED:3420405)].

GO process:cholesterol metabolic process (GO:0008203), lipid catabolic process (GO:0016042)
GO function:lipase activity (GO:0016298)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HSL_N