The domain within your query sequence starts at position 19 and ends at position 505; the E-value for the HSNSD domain shown below is 1.3e-270.

LLETQNLLRTQVANFTFNLGFSGKFYHTGTEEEDEGDDLLLRSVDEFWWFPHMWSHMQPH
LFHNESSLVEQMILNKEFALEHGIPINLGYAVAPHHSGVYPVHIQLYAAWKKVWGIQVTS
TEEYPHLKPARYRKGFIHNSIMVLPRQTCGLFTHTIFYKEYPGGPQELDKSIKGGELFLT
ILLNPDK

HSNSD

HSNSD
PFAM accession number:PF12062
Interpro abstract (IPR021930):

This domain is found in heparan sulphate N-deacetylase enzymes. It is often found associated with.

GO function:hydrolase activity (GO:0016787), [heparan sulfate]-glucosamine N-sulfotransferase activity (GO:0015016)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HSNSD