The domain within your query sequence starts at position 25 and ends at position 514; the E-value for the HSNSD domain shown below is 9.1e-245.

GFSLVSMGFLAYYVSTSPKAKEPLPLPLGDCSSSGAAGPGPARPPVPPRPQRPPETTRTE
PVVLVFVESAYSQLGQEIVAILESSRFRYSTELAPGRGDMPTLTDHTHGRYVLVIYENLL
KYVNLDAWSRELLDRYCVEYGVGIIGFFRAREHSLLSAQLKGFPLFLHSNLGLRDYQVNP
SAPLLHLTRPSRLEPGPLPGDDWTIFQSNHSTYEPVLIASHRPAELSMPGPVLRRARLPT
VVQDLGLHDGIQRVLFGHGLSFWLHKLVFVDAVAYLTGKRLCLDLDRYILVDIDDIFVGK
EGTRMKVADVEALLTTQNKLRTLVPNFTFNLGFSGKFYHTGTEEEDAGDDMLLKHRREFW
WFPHMWSHMQPHLFHNRSVLADQMRLNKQFALEHGIPTDLGYAVAPHHSGVYPIHSQLYE
AWKSVWGIQVTSTEEYPHLRPARYRRGFIHNGIMVLPRQTCGLFTHTIFYNEYPGGSREL
DRSIRGGELF

HSNSD

HSNSD
PFAM accession number:PF12062
Interpro abstract (IPR021930):

This domain is found in heparan sulphate N-deacetylase enzymes. It is often found associated with.

GO function:[heparan sulfate]-glucosamine N-sulfotransferase activity (GO:0015016), hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HSNSD