The domain within your query sequence starts at position 1223 and ends at position 1317; the E-value for the HTH_40 domain shown below is 4.3e-10.
SVAVTYTLFQEKKMPLHSIAENRLLPLTAAGMHLAQAVKAGYPLDMERAGLTPETWKIIM DVIRNPPINSDMYKVKLIRMLVPENLDTYLIHMAI
HTH_40 |
---|
PFAM accession number: | PF14493 |
---|---|
Interpro abstract (IPR029491): | This presumed domain is found at the C terminus of a large number of helicases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HTH_40