The domain within your query sequence starts at position 305 and ends at position 432; the E-value for the HTH_44 domain shown below is 1.3e-28.
VKAAEDDELEEEADWIYRNAFATPTISLQDSCDYLDRGQPTSSFSRKGPSTVQKIKEALG FMRNQHFEVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKMQAYQ YEQISADP
HTH_44 |
---|
PFAM accession number: | PF14641 |
---|---|
Interpro abstract (IPR028088): | This helix-turn-helix represents the first of two DNA-binding domains on the Spt6 proteins [ (PUBMED:21094070) (PUBMED:21844224) ]. |
GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HTH_44