The domain within your query sequence starts at position 305 and ends at position 432; the E-value for the HTH_44 domain shown below is 1.3e-28.

VKAAEDDELEEEADWIYRNAFATPTISLQDSCDYLDRGQPTSSFSRKGPSTVQKIKEALG
FMRNQHFEVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKMQAYQ
YEQISADP

HTH_44

HTH_44
PFAM accession number:PF14641
Interpro abstract (IPR028088):

This helix-turn-helix represents the first of two DNA-binding domains on the Spt6 proteins [(PUBMED:21094070), (PUBMED:21844224)].

GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HTH_44