The domain within your query sequence starts at position 45 and ends at position 177; the E-value for the HbrB domain shown below is 2.8e-36.

LQLSSNSAWNSVQTAVINVFKGGGLQSNELYALNESIRRLLKSELGSFITDYFQNQLLAK
GLSFVEEKIKLCEGDNRIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRD
LVLLKVKLGDVLL

HbrB

HbrB
PFAM accession number:PF08539
Interpro abstract (IPR013745):

This entry includes PRR5 (also known as PROTOR1) from animals, Bit61 and its paralogue-Bit2 from budding yeasts [ (PUBMED:17461779) (PUBMED:14736892) ]. They are part of the Target Of Rapamycin Complex 2 (TORC2) complex, which plays an essential role in signal transduction [ (PUBMED:17303383) ]. The mammalian TORC2 consists of mTOR, MLST8, PRR5, RICTOR, MAPKAP1 and DEPTOR [ (PUBMED:17043309) (PUBMED:15988011) (PUBMED:16962653) (PUBMED:16919458) (PUBMED:23762398) ]. The budding yeast TORC2 is composed of Avo1, Avo2, Tsc11, Lst8, Bit61, Slm, Slm2 and Tor2 [ (PUBMED:26700129) (PUBMED:15689497) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HbrB