The domain within your query sequence starts at position 335 and ends at position 535; the E-value for the Headcase domain shown below is 2.8e-86.

AGHFDTPVQFLRRLDLSELLTHIPRHKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHR
NVVNCALCHRALPVFEQFPLVDGTLFLSPSRHDEIEYDVPCHLQGRLMHLYAVCVDCLEG
VHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQARLNCKHCGKPVIDVRIGMQYFSE
YSNVQQCPHCGNLDYHFVKPF

Headcase

Headcase
PFAM accession number:PF16002
Interpro abstract (IPR031947):

This domain is found in Drosophila headcase protein [(PUBMED:8575315)] and the human headcase protein homologue. Drosophila headcase protein is involved in dendrite pruning [(PUBMED:23197702)] and is a branching inhibitor during tracheal development [(PUBMED:11463742)]. It also promotes cell survival and niche maintenance in the Drosophila testis [(PUBMED:23874487)]. Human headcase protein may play an important role in human carcinogenesis [(PUBMED:11696983), (PUBMED:19643820)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Headcase