The domain within your query sequence starts at position 76 and ends at position 203; the E-value for the Helicase_C_3 domain shown below is 1.2e-46.

LWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSD
ITEYLRKLSKTGVPDGIIQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIR
ECRLRNAE

Helicase_C_3

Helicase_C_3
PFAM accession number:PF13625
Interpro abstract (IPR032830):

This domain is found in the N-terminal region of XPB/Ssl2. XPB/Ssl2 is a component of RNA polymerase transcription factor TFIIH holoenzyme required for DNA unwinding during transcription initiation [(PUBMED:25775526)]. It plays a dual role in transcription and DNA repair [(PUBMED:25641424)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Helicase_C_3