The domain within your query sequence starts at position 870 and ends at position 1146; the E-value for the Helicase_C_4 domain shown below is 3.6e-126.

NTLDELIDELGGPENVAEMTGRKGRVVSNDDGSISYESRSELDVPVEILNITEKQRFMDG
DKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPE
YVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMK
SIVNLDSPMVSPPPDYPGEFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRIL
GMEVHQQNALFQYFADTLTAVVQNAKKNGRYDMGILD

Helicase_C_4

Helicase_C_4
PFAM accession number:PF13871
Interpro abstract (IPR026937): Strawberry notch proteins carry DExD/H-box groups and Helicase_C domains. These proteins promote the expression of diverse targets, potentially through interactions with transcriptional activator or repressor complexes [(PUBMED:20230814)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Helicase_C_4