The domain within your query sequence starts at position 281 and ends at position 488; the E-value for the Helicase_RecD domain shown below is 1.3e-68.
ALTAARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLD YEIVQSLNPEFNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKS LLGPYLVFMASTINGYEGTGRSLSLKLIQQLRQQSAQSQVSTTAENKTTTTARLASARTL HEVSLQESIRYAPGDAVEKWLNDLLCLD
Helicase_RecD |
---|
PFAM accession number: | PF05127 |
---|---|
Interpro abstract (IPR007807): | This domain contains a P-loop (Walker A) motif, suggesting that it has ATPase activity, and a Walker B motif. In tRNA(Met) cytidine acetyltransferase (TmcA) it may function as an RNA helicase motor (driven by ATP hydrolysis) which delivers the wobble base to the active centre of the GCN5-related N-acetyltransferase (GNAT) domain [ (PUBMED:19322199) ]. It is found in the bacterial exodeoxyribonuclease V alpha chain (RecD), which has 5'-3' helicase activity. It is structurally similar to the motor domain 1A in other SF1 helicases [ (PUBMED:15538360) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Helicase_RecD