The domain within your query sequence starts at position 346 and ends at position 414; the E-value for the HemN_C domain shown below is 7.7e-13.
LGKLELLEEVLAMGLRTDVGVTHQHWQQFEPQLTLWDVFGASKEVEELLAQGLLLLDYRG LRCSWEGLA
HemN_C |
---|
PFAM accession number: | PF06969 |
---|---|
Interpro abstract (IPR010723): | This domain is found in the C-terminal region of oxygen-independent coproporphyrinogen-III oxidases (HemN) [ (PUBMED:14633981) ]. This enzyme catalyses the oxygen-independent conversion of coproporphyrinogen-III to protoporphyrinogen-IX [ (PUBMED:12196143) ], one of the last steps in haem biosynthesis. The function of this domain is unclear, but comparison to other proteins containing a radical SAM domain suggest it may be a substrate binding domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HemN_C