The domain within your query sequence starts at position 346 and ends at position 414; the E-value for the HemN_C domain shown below is 7.7e-13.

LGKLELLEEVLAMGLRTDVGVTHQHWQQFEPQLTLWDVFGASKEVEELLAQGLLLLDYRG
LRCSWEGLA

HemN_C

HemN_C
PFAM accession number:PF06969
Interpro abstract (IPR010723):

This domain is found in the C-terminal region of oxygen-independent coproporphyrinogen-III oxidases (HemN) [ (PUBMED:14633981) ]. This enzyme catalyses the oxygen-independent conversion of coproporphyrinogen-III to protoporphyrinogen-IX [ (PUBMED:12196143) ], one of the last steps in haem biosynthesis. The function of this domain is unclear, but comparison to other proteins containing a radical SAM domain suggest it may be a substrate binding domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HemN_C