The domain within your query sequence starts at position 6 and ends at position 105; the E-value for the Hemerythrin domain shown below is 6.1e-7.

DEVDVFTAPHWRMKQLVGRYCDKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPM
LMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNQA

Hemerythrin

Hemerythrin
PFAM accession number:PF01814
Interpro abstract (IPR012312):

This entry represents a haemerythrin cation-binding domain that occurs [ (PUBMED:12625841) ] in haemerythrins, myohemerythrins and related proteins. This domain binds iron in haemerythrin, but can bind other metals in related proteins, such as cadmium in a Nereis diversicolor protein ( P80255 ) [ (PUBMED:12743530) ]. This domain is also found in Repair of iron centres or Ric proteins [ (PUBMED:19140014) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hemerythrin