The domain within your query sequence starts at position 101 and ends at position 197; the E-value for the Hep_59 domain shown below is 3e-34.

SFSAETNRRDEDADMMKYIETELKKRKGIVEQEEQKAKPKNAEDCLYELPENIRVSSAKK
TEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARL

Hep_59

Hep_59
PFAM accession number:PF07052
Interpro abstract (IPR010756):

Tls1 in fission yeast is required for telomeric heterochromatin assembly as well as telomere length control [(PUBMED:25245948)]. The human homologue, also known as hepatocellular carcinoma-associated antigen 59 or C9ORF78, is associated with the spliceosome and is overexpressed in multiple cancer cell lines [(PUBMED:12097419)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hep_59