The domain within your query sequence starts at position 33 and ends at position 84; the E-value for the Hepcidin domain shown below is 9.9e-22.
TTELQPLHGEESRADIAIPMQKRRKRDINFPICRFCCQCCNKPSCGICCEE
Hepcidin |
---|
PFAM accession number: | PF06446 |
---|---|
Interpro abstract (IPR010500): | Hepcidin is a antibacterial and anti-fungal protein expressed in the liver and is also a signalling molecule in iron metabolism. The hepcidin protein is cysteine-rich and forms a distorted beta-sheet with an unusual disulphide bond found at the turn of the hairpin [ (PUBMED:12138110) ]. |
GO process: | cellular iron ion homeostasis (GO:0006879) |
GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hepcidin