The domain within your query sequence starts at position 5 and ends at position 434; the E-value for the HgmA domain shown below is 2e-225.

KYISGFGNECASEDPRCPGSLPKGQNNPQVCPYNLYAEQLSGSAFTCPRNTNKRSWLYRI
LPSVSHKPFESIDQGHVTHNWDEVGPDPNQLRWKPFEIPKASEKKVDFVSGLYTLCGAGD
IKSNNGLAVHIFLCNSSMENRCFYNSDGDFLIVPQKGKLLIYTEFGKMSLQPNEICVIQR
GMRFSVDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPVAWYEDRRVPGGYT
VINKFQGKLFACKQDVSPFNVVAWHGNYTPYKYNLENFMVINAVAFDHADPSIFTVLTAK
SLRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIKGHYEAKQGGFLPGGGSL
HSAMTPHGPDADCFEKASKAKLEPERIADGTMAFMFESSLSLAVTKWGLKTCSCLDENYY
KCWEPLRSHF

HgmA

HgmA
PFAM accession number:PF04209
Interpro abstract (IPR005708):

Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism. The deficiency causes homogentisic aciduria, ochronosis, and arthritis. AKU patients are deficient for homogentisate 1,2 dioxygenase (EC 1.13.11.5), the enzyme that mediates the conversion of homogentisate to maleylacetoacetate; a step in the catabolism of both tyrosine and phenylalanine. Homogentisate + O(2) = 4-maleylacetoacetate.

GO process:tyrosine metabolic process (GO:0006570), L-phenylalanine catabolic process (GO:0006559), oxidation-reduction process (GO:0055114)
GO function:homogentisate 1,2-dioxygenase activity (GO:0004411)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HgmA