The domain within your query sequence starts at position 56 and ends at position 168; the E-value for the HhH-GPD domain shown below is 2.7e-5.

IATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFS
DEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWEN

HhH-GPD

HhH-GPD
PFAM accession number:PF00730
Interpro abstract (IPR003265):

The HhH-GPD superfamily gets its name from its hallmark helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate [(PUBMED:10706276), (PUBMED:8805338)]. This domain is found in a diverse range of structurally related DNA repair proteins that include: endonuclease III, EC 4.2.99.18 and DNA glycosylase MutY, an A/G-specific adenine glycosylase. Both of these enzymes have a C-terminal iron-sulphur cluster loop (FCL). The methyl-CPG binding protein (MBD4) also contain a related domain that is a thymine DNA glycosylase [(PUBMED:10499592)]. The family also includes DNA-3-methyladenine glycosylase II EC 3.2.2.21, 8-oxoguanine DNA glycosylases and other members of the AlkA family.

GO process:base-excision repair (GO:0006284)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HhH-GPD