The domain within your query sequence starts at position 1 and ends at position 785; the E-value for the Hid1 domain shown below is 2.3e-261.

MGSADSKLNFRKAVIQLTTKTQPVEATDNAFWDQFWADTATSVQDVFALVPAAEIRAVRE
ESPSNLATLCYKAVEKLVQGAEGGCHSEKEKQVVLNCSRLLTRVLPYIFEDPDWRGFFWS
TVPGAGRGGQGEEEDENARPLAESLLLAIADLLFCPDFTVQNHRRNDVDSAEDVHSLDSC
EYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPSPESGSTNPWVQFFCST
ENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIVTLDHDSATST
SPTVDGTTTGTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLSNPLLQTYLPN
STKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDILVPILYFLNDARADQSRVGLMH
IGVFILLLLSGERNFGVRLNKPYSVRVPMDIPVFTGTHADLLIVVFHKIITSGHQRLQPL
FDCLLTIVVNVSPYLKSLSMVTANKLLHLLEAFSTTWFLFSASQNHHLVFFLLEVFNNII
QYQFDGNSNLVYAIIRKRAVFHQLANLPTDPPSIHKALQRRRRTPEPLSRTGSQEGTSME
GSRPAAPAEPGTLKTSLVATPGIDKLTEKSQVSEDGTLRSLEPESQQSSAENSPSDGESS
QTWREQRRLSNASASGQWSPTSDWILSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDE
SEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAMWFRTYMWGVIYLRNVDPPIWYDTDV
KLFEI

Hid1

Hid1
PFAM accession number:PF12722
Interpro abstract (IPR026705):

Hid-1 (high-temperature-induced dauer-formation protein 1) was originally identified as a Caenorhabditis elegans gene encoding a protein that regulates larval development [(PUBMED:14504222)]. HID-1 is conserved from fungi to humans. It contains up to seven potential transmembrane domains separated by regions of low complexity. It may control the correct sorting of DCV (dense core vesicle, also known as the secretory granule) cargoes in the Golgi apparatus [(PUBMED:2125094)].

Mammalian HID-1 localized to the medial- and trans- Golgi apparatus as well as the cytosol and may be involved in the intracellular trafficking within the Golgi region [(PUBMED:21337012)].

This entry also includes Ecm30 from budding yeasts. The function of Ecm30 is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hid1