The domain within your query sequence starts at position 761 and ends at position 960; the E-value for the Hira domain shown below is 2.9e-61.

CGRRLLPPILLPSPISTLHCTGPYVMALTAAATLSVWDVHRQVVVVKEESLHSILSGSDM
TVSQILLTQHGIPVMNLSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRNSLPSQDAMLC
SGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLLY
ARYLVNEGFEYRLREICKDL

Hira

Hira
PFAM accession number:PF07569
Interpro abstract (IPR011494):

The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin. These proteins also contain IPR001680.

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hira