The domain within your query sequence starts at position 4 and ends at position 76; the E-value for the Histone domain shown below is 2.1e-8.

KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAK
TMTTSHLKQCIEL

Histone

Histone
PFAM accession number:PF00125
Interpro abstract (IPR007125):

Five major families of histones exist: H1/H5, H2A, H2B, H3, and H4 [(PUBMED:16472024)] Histones H2A, H2B, H3 and H4 are known as the core histones, while histones H1 and H5 are known as the linker histones. The core histones together with some other DNA binding proteins form a superfamily defined by a common fold and distant sequence similarities [(PUBMED:7651829), (PUBMED:9016552)]. Some proteins contain local homology domains related to the histone fold [(PUBMED:9305837)].

This entry represents a domain found in histones H2A, H2B and H3.

GO component:nucleosome (GO:0000786)
GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Histone