The domain within your query sequence starts at position 29 and ends at position 255; the E-value for the HlyIII domain shown below is 6.4e-51.

FQMTNETLNIWTHLLPFWFFVWRFMTALYVTDIQNDSYSWPMLVYMCTSCVYPLASSCAH
TFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALVCSTFHECYVALAVLNTIL
STGLSCYSRFLELQKPRLCKLLRVLAFAYPYTWDSLPIFYRLFLFPGESSRNEAMLYHQK
HMGMTLLASFFYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHLQM

HlyIII

HlyIII
PFAM accession number:PF03006
Interpro abstract (IPR004254):

Members of this family are integral membrane proteins. This family includes a protein with hemolytic activity from Bacillus cereus [(PUBMED:7495855)]. YOL002c (AdipoR-like receptor IZH2) from Saccharomyces cerevisiae encodes a protein that plays a key role in metabolic pathways that regulate lipid and phosphate metabolism [(PUBMED:11916977), (PUBMED:15664187)]. In eukaryotes, members are seven-transmembrane pass molecules found to encode functional receptors with a broad range of apparent ligand specificities, including progestin and adiponectin (AdipoQ) receptors (AdipoR), and hence have been named PAQR proteins [(PUBMED:16044242)]. The mammalian members include progesterone binding proteins [(PUBMED:17082257)]. Unlike the case with GPCR receptor proteins, the evolutionary ancestry of the members of this family can be traced back to the Archaea.

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HlyIII