The domain within your query sequence starts at position 40 and ends at position 69; the E-value for the HnRNP_M domain shown below is 2.7e-20.
ERPTQNEKRKEKNIKRGGNRFEPYSNPTKR
HnRNP_M |
![]() |
---|
PFAM accession number: | PF11532 |
---|---|
Interpro abstract (IPR024666): | Heterogeneous nuclear ribonucleoproteins (hnRNPs) bind directly to nascent RNA polymerase II transcripts and play an important role in both transcript-specific packaging and alternative splicing of pre-mRNAs [ (PUBMED:8441656) ]. hnRNP M proteins are an abundant group of hnRNPs that have been shown to bind avidly to poly(G) and poly(U) RNA homopolymers [ (PUBMED:8441656) ]. hnRNP M family members are able to induce exon skipping and promote exon inclusion, suggesting that the proteins may broadly contribute to the fidelity of splice site recognition and alternative splicing regulation [ (PUBMED:17959601) ]. This entry represents the N-terminal PY nuclear localisation signal of heterogeneous nuclear ribonucleoprotein M [ (PUBMED:17435768) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HnRNP_M