The domain within your query sequence starts at position 283 and ends at position 313; the E-value for the Homeobox_KN domain shown below is 2e-12.

WLFQHLSHPYPSEEQKKQLAQDTGLTILQVY

Homeobox_KN

Homeobox_KN
PFAM accession number:PF05920
Interpro abstract (IPR008422):

This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [ (PUBMED:17429685) ]. Genes encoding these proteins were first identified as TALE homeobox proteins in eukaryotes, (including KNOX and MEIS genes) [ (PUBMED:17429685) (PUBMED:8537382) (PUBMED:9336443) ]. They have been classified [ (PUBMED:17665086) (PUBMED:19734295) (PUBMED:21557080) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Homeobox_KN