The domain within your query sequence starts at position 421 and ends at position 477; the E-value for the Homez domain shown below is 3.6e-25.

PLPAPPPPPDIRPLEKYWAAHQQLQEADILKLSQASRLSTQQVLDWFDSRLPKPAEV

Homez

Homez
PFAM accession number:PF11569
Interpro abstract (IPR024578):

Homez contains three atypical homeobox domains, two leucine zipper-like motifs and an acidic domain and belongs to the superfamily of homeobox-containing proteins. The presence of leucine zippers suggests that Homez can function as a homo or heterodimer in the nucleus [ (PUBMED:12925734) ]. It is thought that the first leucine zipper and homeodomain 1 (HD1) of Homez is responsible for dimerisation and HD2 has a specific DNA-binding activity. Homez is also thought to function as a transcriptional repressor due to the acidic region in its C-terminal domain [ (PUBMED:12925734) ]. Homez is involved in a complex regulatory network [ (PUBMED:12925734) ].

This entry represents a homeobox domain found in Homez (HD3).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Homez