The domain within your query sequence starts at position 1 and ends at position 96; the E-value for the Hox9_act domain shown below is 5e-42.

MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFG
ASWAPLSPHASGSLPSVYHPYLQPQGAPAAESSQPL

Hox9_act

Hox9_act
PFAM accession number:PF04617
Interpro abstract (IPR006711):

This domain constitutes the N-terminal of the paralogous homeobox proteins HoxA9, HoxB9, HoxC9 and HoxD9. The N-terminal region is thought to act as a transcription activation region. Activation may be by interaction with proteins such as Btg proteins, which are thought to recruit a multi-protein Ccr4-like complex [ (PUBMED:10617598) ].

GO process:transcription, DNA-templated (GO:0006351)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hox9_act