The domain within your query sequence starts at position 20 and ends at position 99; the E-value for the Hyccin domain shown below is 3e-33.

PDTQITSYAATLHRKKALVPALYKVIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFL
PELIWVYLRLTVSRDRQSN

Hyccin

Hyccin
PFAM accession number:PF09790
Interpro abstract (IPR018619):

Members of this family of proteins may have a role in the beta-catenin-Tcf/Lef signaling pathway, as well as in the process of myelination of the central and peripheral nervous system. Defects in Hyccin are the cause of hypomyelination with congenital cataracts [MIM:610532]. This disorder is characterised by congenital cataracts, progressive neurologic impairment, and diffuse myelin deficiency. Affected individuals experience progressive pyramidal and cerebellar dysfunction, muscle weakness and wasting prevailing in the lower limbs [(PUBMED:16951682), (PUBMED:10910037)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hyccin