SMART: Pfam domain Hyccin

The domain within your query sequence starts at position 22 and ends at position 330; the E-value for the Hyccin domain shown below is 2.7e-133.

TSLPNYATNLKDKSSLVTSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLRFTLQFLPE
LMWCYLAVSASRDVHSSGCIEALLLGVYNLEIVDKHGHSKVLSFTIPSLSKPSVYHEPSS
IGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQ
SLCQICSRICVCGYPRQHVRKYRGVSSRIPISSGFMVQMLTGVYFAIYNGEWDLAQKALD
DIIYRAQLELYPEPLLVANAIKASLPHGAMKSSKEGTRCIQVEITPTSSRISRNAVTSMS
IRGHRWKRH

Hyccin

PFAM accession number:	PF09790
Interpro abstract (IPR018619):	Members of this family of proteins may have a role in the beta-catenin-Tcf/Lef signaling pathway, as well as in the process of myelination of the central and peripheral nervous system. Defects in Hyccin are the cause of hypomyelination with congenital cataracts. This disorder is characterised by congenital cataracts, progressive neurologic impairment, and diffuse myelin deficiency. Affected individuals experience progressive pyramidal and cerebellar dysfunction, muscle weakness and wasting prevailing in the lower limbs [ (PUBMED:16951682) (PUBMED:10910037) ].

PFAM accession number:

PF09790

Interpro abstract (IPR018619):

Members of this family of proteins may have a role in the beta-catenin-Tcf/Lef signaling pathway, as well as in the process of myelination of the central and peripheral nervous system. Defects in Hyccin are the cause of hypomyelination with congenital cataracts. This disorder is characterised by congenital cataracts, progressive neurologic impairment, and diffuse myelin deficiency. Affected individuals experience progressive pyramidal and cerebellar dysfunction, muscle weakness and wasting prevailing in the lower limbs [ (PUBMED:16951682) (PUBMED:10910037) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hyccin