The domain within your query sequence starts at position 9 and ends at position 53; the E-value for the Hydant_A_N domain shown below is 8.2e-14.

HFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRR

Hydant_A_N

Hydant_A_N
PFAM accession number:PF05378
Interpro abstract (IPR008040):

This domain is found at the N terminus of the hydantoinase/oxoprolinase IPR002821 family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hydant_A_N