The domain within your query sequence starts at position 108 and ends at position 229; the E-value for the Hydrolase_4 domain shown below is 7e-10.
PGARYTVLFSHGNAVDLGQMCSFYVGLGTRIGCNIFSYDYSGYGISSGRPSEKNLYADID AAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKK TY
Hydrolase_4 |
---|
PFAM accession number: | PF12146 |
---|---|
Interpro abstract (IPR022742): | This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. The majority of the members in this entry carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in Q7ZWC2 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hydrolase_4