The domain within your query sequence starts at position 55 and ends at position 142; the E-value for the Hydrolase_4 domain shown below is 1.7e-8.

NSRIFYREVLPIQQARRAEVVFLHGKAFNSHTWEQLGTLQLLSERGYRAVAIDLPGFGNS
APSEEVSTEAGRVELLERVFQDLQVQNT

Hydrolase_4

Hydrolase_4
PFAM accession number:PF12146
Interpro abstract (IPR022742):

This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. The majority of the members in this entry carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in Q7ZWC2 .

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hydrolase_4