The domain within your query sequence starts at position 1 and ends at position 61; the E-value for the IATP domain shown below is 1.8e-28.

MDTGAGSIREAGGAFGKREKAEEDRYFREKTKEQLAALRKHHEDEIDHHSKEIERLQKQI
E

IATP

IATP
PFAM accession number:PF04568
Interpro abstract (IPR007648):

ATP synthase inhibitor prevents the enzyme from switching to ATP hydrolysis during collapse of the electrochemical gradient, for example during oxygen deprivation [ (PUBMED:12186878) ] ATP synthase inhibitor forms a one to one complex with the F1 ATPase, possibly by binding at the alpha-beta interface. It is thought to inhibit ATP synthesis by preventing the release of ATP [ (PUBMED:8961923) ]. The minimum inhibitory region for bovine inhibitor ( P01096 ) is from residues 39 to 72 [ (PUBMED:8961923) ]. The inhibitor has two oligomeric states, dimer (the active state) and tetramer. At low pH the inhibitor forms a dimer via antiparallel coiled coil interactions between the C-terminal regions of two monomers. At high pH, the inhibitor forms tetramers and higher oligomers by coiled coil interactions involving the N terminus and inhibitory region, thus preventing the inhibitory activity [ (PUBMED:12186878) ].

GO process:negative regulation of ATPase activity (GO:0032780)
GO component:mitochondrion (GO:0005739)
GO function:ATPase inhibitor activity (GO:0042030)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IATP