The domain within your query sequence starts at position 260 and ends at position 301; the E-value for the ICA69 domain shown below is 4.1e-12.

PYEFTTLKSLQDPMKKLVEKEGKKTSWRENREAVAPEPRQTH

ICA69

ICA69
PFAM accession number:PF04629
Interpro abstract (IPR006723): This entry represents a C-terminal domain found in islet cell autoantigen Ica1. Ica1 has been identified as an islet cell autoantigen in type I diabetes mellitus [(PUBMED:8975715)]. Its precise function is unknown, though it may play a role in neurotransmitter secretion [(PUBMED:11029035)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ICA69