The domain within your query sequence starts at position 260 and ends at position 301; the E-value for the ICA69 domain shown below is 4.1e-12.

PYEFTTLKSLQDPMKKLVEKEGKKTSWRENREAVAPEPRQTH

ICA69

• PFAM accession number: PF04629
• Interpro abstract (IPR006723):

  This entry represents a C-terminal domain found in islet cell autoantigen Ica1. Ica1 has been identified as an islet cell autoantigen in type I diabetes mellitus [ (PUBMED:8975715) ]. Its precise function is unknown, though it may play a role in neurotransmitter secretion [ (PUBMED:11029035) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ICA69