The domain within your query sequence starts at position 113 and ends at position 188; the E-value for the ICAT domain shown below is 5.7e-36.
MDRDLMVGKLERELYTQRKVEILTALRKLGEKLTEDDETFLSANASAVLSQFEKVSTELG SGDKVLALAGFDVEKA
ICAT |
---|
PFAM accession number: | PF06384 |
---|---|
Interpro abstract (IPR009428): | This domain is characteristic of eukaryotic beta-catenin-interacting (ICAT) proteins. Beta-catenin is a multifunctional protein involved in both cell adhesion and transcriptional activation. Transcription mediated by the beta-catenin/Tcf complex is involved in embryological development and is upregulated in various cancers. ICAT selectively inhibits beta-catenin/Tcf binding in vivo without disrupting beta-catenin/cadherin interactions [ (PUBMED:12408824) ]. Protein LZIC contains a leucine zipper domain and an ICAT homologous domain, with particular conservation of residues that are used by ICAT for beta-catenin-binding [ (PUBMED:11712074) (PUBMED:15932753) ]. |
GO function: | beta-catenin binding (GO:0008013) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ICAT