The domain within your query sequence starts at position 113 and ends at position 188; the E-value for the ICAT domain shown below is 5.7e-36.

MDRDLMVGKLERELYTQRKVEILTALRKLGEKLTEDDETFLSANASAVLSQFEKVSTELG
SGDKVLALAGFDVEKA

ICAT

ICAT
PFAM accession number:PF06384
Interpro abstract (IPR009428):

This domain is characteristic of eukaryotic beta-catenin-interacting (ICAT) proteins. Beta-catenin is a multifunctional protein involved in both cell adhesion and transcriptional activation. Transcription mediated by the beta-catenin/Tcf complex is involved in embryological development and is upregulated in various cancers. ICAT selectively inhibits beta-catenin/Tcf binding in vivo without disrupting beta-catenin/cadherin interactions [ (PUBMED:12408824) ].

Protein LZIC contains a leucine zipper domain and an ICAT homologous domain, with particular conservation of residues that are used by ICAT for beta-catenin-binding [ (PUBMED:11712074) (PUBMED:15932753) ].

GO function:beta-catenin binding (GO:0008013)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ICAT