The domain within your query sequence starts at position 1 and ends at position 211; the E-value for the IER domain shown below is 6.2e-51.
MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSDPCPGLYLAGP AGTPAVPPPQQPGEPVAGPPSGWGEPPPPVARAAWPEPEPQPQPQPQRPSVCHTPGAGSS EPVAAVAGSGEALRGGEEDSAAAAWGRVERPRAASSGGGSDACPEGPRAVRRPCGCPPAV EERSSEDGSPAPPAPCPRKRGAAGVGGGRAS
IER |
---|
PFAM accession number: | PF05760 |
---|---|
Interpro abstract (IPR008653): | This family consists of eukaryotic immediate early response (IER) proteins 2 and 5. The role of IER5 is unclear, although it plays an important role in mediating the cellular response to mitogenic signals. Again, little is known about the function of IER2, although it is thought to play a role in mediating cellular responses to a variety of extracellular signals [ (PUBMED:11102586) (PUBMED:10049588) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IER