The domain within your query sequence starts at position 152 and ends at position 240; the E-value for the IF3_C domain shown below is 1.8e-22.
PTMTKELVFSSNIGQHDLDTKSKQIQQWIEKKYHVQVTIKRRKDAEQSEEETEEIFNQIL QTMPDIATFSSRPKAIRGGTASMCVFRHL
IF3_C |
 |
|---|
| PFAM accession number: | PF00707 |
|---|---|
| Interpro abstract (IPR019815): | Initiation factor 3 (IF-3) (gene infC) is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-3 is thought to function as a fidelity factor during the assembly of the ternary initiation complex which consist of the 30S ribosomal subunit, the initiator tRNA and the messenger RNA. IF-3 is a basic protein that binds to the 30S ribosomal subunit [ (PUBMED:8405963) ]. The chloroplast initiation factor IF-3(chl) is a protein that enhances the poly(A,U,G)-dependent binding of the initiator tRNA to chloroplast ribosomal 30s subunits in which the central section is evolutionary related to the sequence of bacterial IF-3 [ (PUBMED:8144528) ]. |
| GO process: | translational initiation (GO:0006413) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IF3_C