The domain within your query sequence starts at position 70 and ends at position 144; the E-value for the IF3_N domain shown below is 5e-16.

DAFSNTGRKISERIIRVLDEKGMDLGMMHRADVIRLMNKQDLRLVQRNTSSEPPEYQLMT
GEQIHQERLKLREQE

IF3_N

IF3_N
PFAM accession number:PF05198
Interpro abstract (IPR019814):

Initiation factor 3 (IF-3) (gene infC) is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-3 is thought to function as a fidelity factor during the assembly of the ternary initiation complex which consist of the 30S ribosomal subunit, the initiator tRNA and the messenger RNA. IF-3 is a basic protein that binds to the 30S ribosomal subunit [(PUBMED:8405963)]. The chloroplast initiation factor IF-3(chl) is a protein that enhances the poly(A,U,G)-dependent binding of the initiator tRNA to chloroplast ribosomal 30s subunits in which the central section is evolutionary related to the sequence of bacterial IF-3 [(PUBMED:8144528)].

GO process:translational initiation (GO:0006413)
GO function:translation initiation factor activity (GO:0003743)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IF3_N